Web Analysis for Justsilver - justsilver.biz
1.67
Rating by CuteStat
justsilver.biz is 9 years 10 months old. It is a domain having biz extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, justsilver.biz is SAFE to browse.
PageSpeed Score
96
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 1 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 23.229.194.8)
ACS Roofing Company | (832) 593-0027
- acsroofingcompany.com
This is valuable website which provides the information about the ACS Roofing Company.
13,213,249
$
8.95
Accent Builders DFW
- accentbuildersdfw.com
This is a valuable website which provides information about the Accent Builder DFW
Not Applicable
$
8.95
Lawn Sprinkler System in Cincinnati | Paramount Landscaping (513) 984-
- cincinnatilawnsprinklersystem.com
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Wed, 16 Sep 2015 22:55:58 GMT
Server: Apache/2.4.12
Last-Modified: Tue, 03 Jun 2014 13:39:43 GMT
ETag: "1f4003a-348-4faeea4fac0ea"
Accept-Ranges: bytes
Content-Length: 840
Content-Type: text/html
Date: Wed, 16 Sep 2015 22:55:58 GMT
Server: Apache/2.4.12
Last-Modified: Tue, 03 Jun 2014 13:39:43 GMT
ETag: "1f4003a-348-4faeea4fac0ea"
Accept-Ranges: bytes
Content-Length: 840
Content-Type: text/html
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns15.domaincontrol.com | 97.74.107.8 | United States of America | |
ns16.domaincontrol.com | 173.201.75.8 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
justsilver.biz | A | 599 |
IP: 23.229.194.8 |
justsilver.biz | NS | 3599 |
Target: ns16.domaincontrol.com |
justsilver.biz | NS | 3599 |
Target: ns15.domaincontrol.com |
justsilver.biz | SOA | 86399 |
MNAME: ns15.domaincontrol.com RNAME: dns.jomax.net Serial: 2014060302 Refresh: 86400 Retry: 7200 Expire: 3600000 Minimum TTL: 86400 |
justsilver.biz | MX | 3599 |
Target: smtp.secureserver.net |
justsilver.biz | MX | 3599 |
Priority: 10 Target: mailstore1.secureserver.net |
Full WHOIS Lookup
Domain Name: JUSTSILVER.BIZ
Domain ID: D60600196-BIZ
Sponsoring Registrar: GODADDY.COM, INC.
Sponsoring Registrar IANA ID: 146
Registrar URL (registration services): whois.godaddy.com
Domain Status: clientDeleteProhibited
Domain Status: clientRenewProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Variant: JUSTSILVER.BIZ
Registrant ID: CR169723381
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Registrant Address1: DomainsByProxy.com
Registrant Address2: 14747 N Northsight Blvd Suite 111, PMB 309
Registrant City: Scottsdale
Registrant State/Province: Arizona
Registrant Postal Code: 85260
Registrant Country: United States
Registrant Country Code: US
Registrant Phone Number: +1.4806242599
Registrant Facsimile Number: +1.4806242598
Registrant Email: JUSTSILVER.BIZ@domainsbyproxy.com
Administrative Contact ID: CR169723383
Administrative Contact Name: Registration Private
Administrative Contact Organization: Domains By Proxy, LLC
Administrative Contact Address1: DomainsByProxy.com
Administrative Contact Address2: 14747 N Northsight Blvd Suite 111, PMB 309
Administrative Contact City: Scottsdale
Administrative Contact State/Province: Arizona
Administrative Contact Postal Code: 85260
Administrative Contact Country: United States
Administrative Contact Country Code: US
Administrative Contact Phone Number: +1.4806242599
Administrative Contact Facsimile Number: +1.4806242598
Administrative Contact Email: JUSTSILVER.BIZ@domainsbyproxy.com
Billing Contact ID: CR169723384
Billing Contact Name: Registration Private
Billing Contact Organization: Domains By Proxy, LLC
Billing Contact Address1: DomainsByProxy.com
Billing Contact Address2: 14747 N Northsight Blvd Suite 111, PMB 309
Billing Contact City: Scottsdale
Billing Contact State/Province: Arizona
Billing Contact Postal Code: 85260
Billing Contact Country: United States
Billing Contact Country Code: US
Billing Contact Phone Number: +1.4806242599
Billing Contact Facsimile Number: +1.4806242598
Billing Contact Email: JUSTSILVER.BIZ@domainsbyproxy.com
Technical Contact ID: CR169723382
Technical Contact Name: Registration Private
Technical Contact Organization: Domains By Proxy, LLC
Technical Contact Address1: DomainsByProxy.com
Technical Contact Address2: 14747 N Northsight Blvd Suite 111, PMB 309
Technical Contact City: Scottsdale
Technical Contact State/Province: Arizona
Technical Contact Postal Code: 85260
Technical Contact Country: United States
Technical Contact Country Code: US
Technical Contact Phone Number: +1.4806242599
Technical Contact Facsimile Number: +1.4806242598
Technical Contact Email: JUSTSILVER.BIZ@domainsbyproxy.com
Name Server: NS15.DOMAINCONTROL.COM
Name Server: NS16.DOMAINCONTROL.COM
Created by Registrar: GODADDY.COM, INC.
Last Updated by Registrar: GODADDY.COM, INC.
Domain Registration Date: Tue Jun 03 09:12:48 GMT 2014
Domain Expiration Date: Thu Jun 02 23:59:59 GMT 2016
Domain Last Updated Date: Wed Jun 03 10:09:03 GMT 2015
DNSSEC: false
>>>> Whois database was last updated on: Wed Sep 16 22:54:25 GMT 2015
Domain ID: D60600196-BIZ
Sponsoring Registrar: GODADDY.COM, INC.
Sponsoring Registrar IANA ID: 146
Registrar URL (registration services): whois.godaddy.com
Domain Status: clientDeleteProhibited
Domain Status: clientRenewProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Variant: JUSTSILVER.BIZ
Registrant ID: CR169723381
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Registrant Address1: DomainsByProxy.com
Registrant Address2: 14747 N Northsight Blvd Suite 111, PMB 309
Registrant City: Scottsdale
Registrant State/Province: Arizona
Registrant Postal Code: 85260
Registrant Country: United States
Registrant Country Code: US
Registrant Phone Number: +1.4806242599
Registrant Facsimile Number: +1.4806242598
Registrant Email: JUSTSILVER.BIZ@domainsbyproxy.com
Administrative Contact ID: CR169723383
Administrative Contact Name: Registration Private
Administrative Contact Organization: Domains By Proxy, LLC
Administrative Contact Address1: DomainsByProxy.com
Administrative Contact Address2: 14747 N Northsight Blvd Suite 111, PMB 309
Administrative Contact City: Scottsdale
Administrative Contact State/Province: Arizona
Administrative Contact Postal Code: 85260
Administrative Contact Country: United States
Administrative Contact Country Code: US
Administrative Contact Phone Number: +1.4806242599
Administrative Contact Facsimile Number: +1.4806242598
Administrative Contact Email: JUSTSILVER.BIZ@domainsbyproxy.com
Billing Contact ID: CR169723384
Billing Contact Name: Registration Private
Billing Contact Organization: Domains By Proxy, LLC
Billing Contact Address1: DomainsByProxy.com
Billing Contact Address2: 14747 N Northsight Blvd Suite 111, PMB 309
Billing Contact City: Scottsdale
Billing Contact State/Province: Arizona
Billing Contact Postal Code: 85260
Billing Contact Country: United States
Billing Contact Country Code: US
Billing Contact Phone Number: +1.4806242599
Billing Contact Facsimile Number: +1.4806242598
Billing Contact Email: JUSTSILVER.BIZ@domainsbyproxy.com
Technical Contact ID: CR169723382
Technical Contact Name: Registration Private
Technical Contact Organization: Domains By Proxy, LLC
Technical Contact Address1: DomainsByProxy.com
Technical Contact Address2: 14747 N Northsight Blvd Suite 111, PMB 309
Technical Contact City: Scottsdale
Technical Contact State/Province: Arizona
Technical Contact Postal Code: 85260
Technical Contact Country: United States
Technical Contact Country Code: US
Technical Contact Phone Number: +1.4806242599
Technical Contact Facsimile Number: +1.4806242598
Technical Contact Email: JUSTSILVER.BIZ@domainsbyproxy.com
Name Server: NS15.DOMAINCONTROL.COM
Name Server: NS16.DOMAINCONTROL.COM
Created by Registrar: GODADDY.COM, INC.
Last Updated by Registrar: GODADDY.COM, INC.
Domain Registration Date: Tue Jun 03 09:12:48 GMT 2014
Domain Expiration Date: Thu Jun 02 23:59:59 GMT 2016
Domain Last Updated Date: Wed Jun 03 10:09:03 GMT 2015
DNSSEC: false
>>>> Whois database was last updated on: Wed Sep 16 22:54:25 GMT 2015